Boltz Workflow: Malaria Binding
About lab
One published Lab
Build with this Lab. Run it anywhere.
Use the same immutable release locally or through managed cloud execution, with its exact version and provenance preserved.
Preparing exact examples…
Guided Boltz-2 workflow for exploring a malaria-related falcipain-2 target with an E-64 reference inhibitor-like ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.
Manifest
{
"io": {
"inputs": [
{
"ui": {
"rows": 6,
"control": "textarea"
},
"name": "protein_sequence",
"label": "Falcipain-2 Sequence",
"format": "sequence",
"maps_to": "falcipain_ligand_setup.protein_sequence",
"required": false,
"value_type": "string",
"description": "Amino-acid sequence for the curated Plasmodium falciparum falcipain-2 target; maps directly to the Boltz-2 protein input."
},
{
"ui": {
"rows": 3,
"control": "textarea"
},
"name": "ligand_smiles",
"label": "E-64 Ligand SMILES",
"format": "smiles",
"maps_to": "falcipain_ligand_setup.ligand_smiles",
"required": false,
"value_type": "string",
"description": "SMILES string for the E-64 reference cysteine-protease inhibitor example; maps directly to the Boltz-2 ligand input."
},
{
"ui": {
"control": "file"
},
"file": {
"accept": [
".a3m",
".fasta",
".fa"
]
},
"name": "msa_path",
"label": "Precomputed MSA Path",
"format": "a3m",
"maps_to": "falcipain_ligand_setup.msa_path",
"required": false,
"value_type": "file",
"description": "Optional path to a precomputed MSA file; leave unset when the configured Boltz MSA server is used."
},
{
"name": "use_msa_server",
"label": "Use MSA Server",
"default": true,
"maps_to": "falcipain_ligand_setup.run_options.use_msa_server",
"value_type": "boolean",
"description": "Use Boltz's MSA server instead of requiring a precomputed MSA file."
},
{
"name": "sampling_steps",
"label": "Sampling Steps",
"default": 200,
"maps_to": "falcipain_ligand_setup.run_options.sampling_steps",
"value_type": "integer",
"description": "Number of Boltz sampling steps for structure generation."
},
{
"name": "recycling_steps",
"label": "Recycling Steps",
"default": 3,
"maps_to": "falcipain_ligand_setup.run_options.recycling_steps",
"value_type": "integer",
"description": "Number of structure recycling steps."
},
{
"name": "diffusion_samples",
"label": "Diffusion Samples",
"default": 1,
"maps_to": "falcipain_ligand_setup.run_options.diffusion_samples",
"value_type": "integer",
"description": "Number of Boltz diffusion samples to generate."
},
{
"name": "output_format",
"label": "Output Format",
"default": "mmcif",
"maps_to": "falcipain_ligand_setup.run_options.output_format",
"value_type": "string",
"description": "Structure artifact format emitted by Boltz.",
"allowed_values": [
"mmcif",
"pdb"
]
},
{
"ui": {
"rows": 6,
"control": "json"
},
"name": "run_options",
"label": "Boltz Run Options",
"format": "json",
"maps_to": "falcipain_ligand_setup.run_options",
"advanced": true,
"required": false,
"value_type": "record",
"description": "Optional structured controls for the Boltz workflow, including source metadata, sampling settings, and interpretation scope."
}
],
"outputs": [
{
"name": "scenario_context",
"label": "Workflow Scenario Context",
"maps_to": "malaria_target_context.scenario_context",
"description": "Source-backed target, ligand, use-case, provenance, and caveat context for this Boltz workflow."
},
{
"name": "assembled_boltz_request",
"label": "Assembled Boltz Request",
"maps_to": "falcipain_ligand_setup.assembled_boltz_request",
"description": "Traceable summary of the protein, ligand, MSA, and run options prepared for Boltz."
},
{
"name": "affinity_summary",
"label": "Affinity-Style Summary",
"maps_to": "boltz_boltz2_affinity_predictor.affinity_summary",
"description": "Parsed Boltz-2 binder probability and affinity-like outputs for this falcipain-ligand prediction."
},
{
"name": "confidence_summary",
"label": "Structure Confidence Summary",
"maps_to": "boltz_boltz2_affinity_predictor.confidence_summary",
"description": "Parsed Boltz-2 confidence outputs for the predicted falcipain-ligand complex."
},
{
"name": "structure_artifacts",
"label": "Predicted Complex Structure Artifacts",
"maps_to": "boltz_boltz2_affinity_predictor.structure_artifacts",
"description": "File-backed predicted complex structures used by the 3D visualisation."
},
{
"name": "run_metadata",
"label": "Boltz Run Metadata",
"maps_to": "boltz_boltz2_affinity_predictor.run_metadata",
"description": "Runtime status, command metadata, logs, and caveats for the latest Boltz invocation."
},
{
"name": "prediction_evidence",
"label": "Conservative Prediction Evidence",
"maps_to": "malaria_prediction_interpreter.prediction_evidence",
"description": "Interpreted Boltz output evidence with request traceability and explicit scientific caveats."
}
]
},
"tags": [
"boltz-workflow",
"boltz",
"protein-ligand",
"affinity",
"structural-biology",
"guided-workflow",
"gpu",
"malaria",
"infectious-disease",
"falcipain-2"
],
"title": "Boltz Workflow: Malaria Binding",
"models": [
{
"path": "models/context",
"alias": "malaria_target_context",
"parameters": {
"scenario": {
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"source_pdb": "3BPF",
"ligand_name": "E-64 reference cysteine-protease inhibitor",
"ligand_role": "reference cysteine-protease inhibitor",
"target_name": "Plasmodium falciparum falcipain-2 cysteine protease",
"disease_area": "malaria target exploration",
"target_family": "falcipain-2 cysteine protease",
"workflow_name": "Malaria Binding Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Plasmodium falciparum falcipain-2 cysteine protease and E-64 reference cysteine-protease inhibitor",
"workflow_question": "What does Boltz-2 predict for this malaria-related protease and reference inhibitor-like ligand?",
"source_pubchem_cid": "123985",
"interpretation_scope": "Learning and early hypothesis generation only",
"protein_sequence_length": 241
},
"integration_step": 0.01
}
},
{
"path": "models/input_assembler",
"alias": "falcipain_ligand_setup",
"parameters": {
"workflow_kind": "single",
"workflow_name": "Malaria Binding Workflow",
"integration_step": 0.01,
"default_run_options": {
"source_pdb": "3BPF",
"ligand_name": "E-64 reference cysteine-protease inhibitor",
"target_name": "Plasmodium falciparum falcipain-2 cysteine protease",
"workflow_name": "Malaria Binding Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Plasmodium falciparum falcipain-2 cysteine protease and E-64 reference cysteine-protease inhibitor",
"source_pubchem_cid": "123985",
"interpretation_scope": "Learning and early hypothesis generation only"
},
"default_ligand_smiles": "CC(C)C[C@@H](C(=O)NCCCCN=C(N)N)NC(=O)[C@@H]1[C@H](O1)C(=O)O",
"default_protein_sequence": "QMNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSCWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE"
}
},
{
"path": "models/core",
"alias": "boltz_boltz2_affinity_predictor",
"parameters": {
"override": true,
"accelerator": "gpu",
"runtime_mode": "managed",
"output_format": "mmcif",
"sampling_steps": 200,
"use_msa_server": true,
"recycling_steps": 3,
"diffusion_samples": 1
}
},
{
"path": "models/interpreter",
"alias": "malaria_prediction_interpreter",
"parameters": {
"mode": "single",
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"core_alias": "boltz_boltz2_affinity_predictor",
"workflow_name": "Malaria Binding Workflow",
"integration_step": 0.01
}
},
{
"path": "models/visualisation",
"alias": "visualisation",
"parameters": {
"mode": "boltz",
"lab_title": "Boltz Workflow: Malaria Binding",
"source_alias": "boltz_boltz2_affinity_predictor",
"context_alias": "malaria_target_context",
"assembler_alias": "falcipain_ligand_setup",
"integration_step": 0.01,
"interpreter_alias": "malaria_prediction_interpreter"
}
}
],
"wiring": [
{
"to": [
"falcipain_ligand_setup.scenario_context",
"malaria_prediction_interpreter.scenario_context",
"visualisation.malaria_target_context_scenario_context"
],
"from": "malaria_target_context.scenario_context"
},
{
"to": [
"boltz_boltz2_affinity_predictor.protein_sequence"
],
"from": "falcipain_ligand_setup.protein_sequence"
},
{
"to": [
"boltz_boltz2_affinity_predictor.ligand_smiles"
],
"from": "falcipain_ligand_setup.ligand_smiles"
},
{
"to": [
"boltz_boltz2_affinity_predictor.msa_path"
],
"from": "falcipain_ligand_setup.msa_path"
},
{
"to": [
"boltz_boltz2_affinity_predictor.run_options"
],
"from": "falcipain_ligand_setup.run_options"
},
{
"to": [
"malaria_prediction_interpreter.assembled_boltz_request",
"visualisation.falcipain_ligand_setup_assembled_boltz_request"
],
"from": "falcipain_ligand_setup.assembled_boltz_request"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_affinity_summary",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_affinity_summary"
],
"from": "boltz_boltz2_affinity_predictor.affinity_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_confidence_summary",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_confidence_summary"
],
"from": "boltz_boltz2_affinity_predictor.confidence_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_structure_artifacts",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_structure_artifacts"
],
"from": "boltz_boltz2_affinity_predictor.structure_artifacts"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_run_metadata",
"malaria_prediction_interpreter.boltz_boltz2_affinity_predictor_run_metadata"
],
"from": "boltz_boltz2_affinity_predictor.run_metadata"
},
{
"to": [
"visualisation.malaria_prediction_interpreter_prediction_evidence"
],
"from": "malaria_prediction_interpreter.prediction_evidence"
}
],
"package": "boltz-malaria-binding-workflow",
"runtime": {
"duration": 0.01,
"settle_steps": 1,
"initial_inputs": {},
"python_version": "3.10",
"communication_step": 0.01
},
"version": "1.0.0",
"description": "Guided Boltz-2 workflow for exploring a malaria-related falcipain-2 target with an E-64 reference inhibitor-like ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.",
"schema_version": "2.0"
}Runtime
Duration0.01
Comms Step0.01
Settle Steps1
Runs
Total0
Completed0
Failed0
Metadata
Packageboltz-malaria-binding-workflow
Created2026-05-23
Updated2026-06-13
boltz-workflowboltzprotein-ligandaffinitystructural-biologyguided-workflowgpumalariainfectious-diseasefalcipain-2contextprovenanceinput-assemblyinterpretationdockingvisualisationother