Boltz Workflow: Cancer Kinase
About lab
One published Lab
Build with this Lab. Run it anywhere.
Use the same immutable release locally or through managed cloud execution, with its exact version and provenance preserved.
Preparing exact examples…
Guided Boltz-2 workflow for exploring a cancer-relevant ABL1 kinase domain with an imatinib reference ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.
Manifest
{
"io": {
"inputs": [
{
"ui": {
"rows": 6,
"control": "textarea"
},
"name": "protein_sequence",
"label": "ABL1 Kinase Sequence",
"format": "sequence",
"maps_to": "abl1_imatinib_setup.protein_sequence",
"required": false,
"value_type": "string",
"description": "Amino-acid sequence for the curated human ABL1 kinase-domain target; maps directly to the Boltz-2 protein input."
},
{
"ui": {
"rows": 3,
"control": "textarea"
},
"name": "ligand_smiles",
"label": "Imatinib Ligand SMILES",
"format": "smiles",
"maps_to": "abl1_imatinib_setup.ligand_smiles",
"required": false,
"value_type": "string",
"description": "SMILES string for the imatinib reference kinase-inhibitor example; maps directly to the Boltz-2 ligand input."
},
{
"ui": {
"control": "file"
},
"file": {
"accept": [
".a3m",
".fasta",
".fa"
]
},
"name": "msa_path",
"label": "Precomputed MSA Path",
"format": "a3m",
"maps_to": "abl1_imatinib_setup.msa_path",
"required": false,
"value_type": "file",
"description": "Optional path to a precomputed MSA file; leave unset when the configured Boltz MSA server is used."
},
{
"name": "use_msa_server",
"label": "Use MSA Server",
"default": true,
"maps_to": "abl1_imatinib_setup.run_options.use_msa_server",
"value_type": "boolean",
"description": "Use Boltz's MSA server instead of requiring a precomputed MSA file."
},
{
"name": "sampling_steps",
"label": "Sampling Steps",
"default": 200,
"maps_to": "abl1_imatinib_setup.run_options.sampling_steps",
"value_type": "integer",
"description": "Number of Boltz sampling steps for structure generation."
},
{
"name": "recycling_steps",
"label": "Recycling Steps",
"default": 3,
"maps_to": "abl1_imatinib_setup.run_options.recycling_steps",
"value_type": "integer",
"description": "Number of structure recycling steps."
},
{
"name": "diffusion_samples",
"label": "Diffusion Samples",
"default": 1,
"maps_to": "abl1_imatinib_setup.run_options.diffusion_samples",
"value_type": "integer",
"description": "Number of Boltz diffusion samples to generate."
},
{
"name": "output_format",
"label": "Output Format",
"default": "mmcif",
"maps_to": "abl1_imatinib_setup.run_options.output_format",
"value_type": "string",
"description": "Structure artifact format emitted by Boltz.",
"allowed_values": [
"mmcif",
"pdb"
]
},
{
"ui": {
"rows": 6,
"control": "json"
},
"name": "run_options",
"label": "Boltz Run Options",
"format": "json",
"maps_to": "abl1_imatinib_setup.run_options",
"advanced": true,
"required": false,
"value_type": "record",
"description": "Optional structured controls for the Boltz workflow, including source metadata, sampling settings, and interpretation scope."
}
],
"outputs": [
{
"name": "scenario_context",
"label": "Workflow Scenario Context",
"maps_to": "cancer_kinase_context.scenario_context",
"description": "Source-backed target, ligand, use-case, provenance, and caveat context for this Boltz workflow."
},
{
"name": "assembled_boltz_request",
"label": "Assembled Boltz Request",
"maps_to": "abl1_imatinib_setup.assembled_boltz_request",
"description": "Traceable summary of the protein, ligand, MSA, and run options prepared for Boltz."
},
{
"name": "affinity_summary",
"label": "Affinity-Style Summary",
"maps_to": "boltz_boltz2_affinity_predictor.affinity_summary",
"description": "Parsed Boltz-2 binder probability and affinity-like outputs for this kinase-ligand prediction."
},
{
"name": "confidence_summary",
"label": "Structure Confidence Summary",
"maps_to": "boltz_boltz2_affinity_predictor.confidence_summary",
"description": "Parsed Boltz-2 confidence outputs for the predicted kinase-ligand complex."
},
{
"name": "structure_artifacts",
"label": "Predicted Complex Structure Artifacts",
"maps_to": "boltz_boltz2_affinity_predictor.structure_artifacts",
"description": "File-backed predicted complex structures used by the 3D visualisation."
},
{
"name": "run_metadata",
"label": "Boltz Run Metadata",
"maps_to": "boltz_boltz2_affinity_predictor.run_metadata",
"description": "Runtime status, command metadata, logs, and caveats for the latest Boltz invocation."
},
{
"name": "prediction_evidence",
"label": "Conservative Prediction Evidence",
"maps_to": "kinase_prediction_interpreter.prediction_evidence",
"description": "Interpreted Boltz output evidence with request traceability and explicit scientific caveats."
}
]
},
"tags": [
"boltz-workflow",
"boltz",
"protein-ligand",
"affinity",
"structural-biology",
"guided-workflow",
"gpu",
"cancer",
"kinase",
"abl1"
],
"title": "Boltz Workflow: Cancer Kinase",
"models": [
{
"path": "models/context",
"alias": "cancer_kinase_context",
"parameters": {
"scenario": {
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"source_pdb": "2HYY",
"ligand_name": "Imatinib reference kinase inhibitor",
"ligand_role": "reference kinase inhibitor",
"target_name": "Human ABL1 kinase domain",
"disease_area": "cancer kinase inhibition",
"target_family": "ABL1 kinase domain",
"workflow_name": "Cancer Kinase Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Human ABL1 kinase domain and Imatinib reference kinase inhibitor",
"workflow_question": "What does Boltz-2 predict for this cancer-relevant kinase domain and reference ligand?",
"source_pubchem_cid": "5291",
"interpretation_scope": "Learning and early hypothesis generation only",
"protein_sequence_length": 273
},
"integration_step": 0.01
}
},
{
"path": "models/input_assembler",
"alias": "abl1_imatinib_setup",
"parameters": {
"workflow_kind": "single",
"workflow_name": "Cancer Kinase Workflow",
"integration_step": 0.01,
"default_run_options": {
"source_pdb": "2HYY",
"ligand_name": "Imatinib reference kinase inhibitor",
"target_name": "Human ABL1 kinase domain",
"workflow_name": "Cancer Kinase Workflow",
"workflow_context": "Guided Boltz-2 known-example workflow for Human ABL1 kinase domain and Imatinib reference kinase inhibitor",
"source_pubchem_cid": "5291",
"interpretation_scope": "Learning and early hypothesis generation only"
},
"default_ligand_smiles": "CC1=C(C=C(C=C1)NC(=O)C2=CC=C(C=C2)CN3CCN(CC3)C)NC4=NC=CC(=N4)C5=CN=CC=C5",
"default_protein_sequence": "VSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES"
}
},
{
"path": "models/core",
"alias": "boltz_boltz2_affinity_predictor",
"parameters": {
"override": true,
"accelerator": "gpu",
"runtime_mode": "managed",
"output_format": "mmcif",
"sampling_steps": 200,
"use_msa_server": true,
"recycling_steps": 3,
"diffusion_samples": 1
}
},
{
"path": "models/interpreter",
"alias": "kinase_prediction_interpreter",
"parameters": {
"mode": "single",
"caveat": "Boltz-2 outputs are computational structure and affinity-style predictions for hypothesis generation; they are not experimental binding, potency, selectivity, clinical, or efficacy evidence.",
"core_alias": "boltz_boltz2_affinity_predictor",
"workflow_name": "Cancer Kinase Workflow",
"integration_step": 0.01
}
},
{
"path": "models/visualisation",
"alias": "visualisation",
"parameters": {
"mode": "boltz",
"lab_title": "Boltz Workflow: Cancer Kinase",
"source_alias": "boltz_boltz2_affinity_predictor",
"context_alias": "cancer_kinase_context",
"assembler_alias": "abl1_imatinib_setup",
"integration_step": 0.01,
"interpreter_alias": "kinase_prediction_interpreter"
}
}
],
"wiring": [
{
"to": [
"abl1_imatinib_setup.scenario_context",
"kinase_prediction_interpreter.scenario_context",
"visualisation.cancer_kinase_context_scenario_context"
],
"from": "cancer_kinase_context.scenario_context"
},
{
"to": [
"boltz_boltz2_affinity_predictor.protein_sequence"
],
"from": "abl1_imatinib_setup.protein_sequence"
},
{
"to": [
"boltz_boltz2_affinity_predictor.ligand_smiles"
],
"from": "abl1_imatinib_setup.ligand_smiles"
},
{
"to": [
"boltz_boltz2_affinity_predictor.msa_path"
],
"from": "abl1_imatinib_setup.msa_path"
},
{
"to": [
"boltz_boltz2_affinity_predictor.run_options"
],
"from": "abl1_imatinib_setup.run_options"
},
{
"to": [
"kinase_prediction_interpreter.assembled_boltz_request",
"visualisation.abl1_imatinib_setup_assembled_boltz_request"
],
"from": "abl1_imatinib_setup.assembled_boltz_request"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_affinity_summary",
"kinase_prediction_interpreter.boltz_boltz2_affinity_predictor_affinity_summary"
],
"from": "boltz_boltz2_affinity_predictor.affinity_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_confidence_summary",
"kinase_prediction_interpreter.boltz_boltz2_affinity_predictor_confidence_summary"
],
"from": "boltz_boltz2_affinity_predictor.confidence_summary"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_structure_artifacts",
"kinase_prediction_interpreter.boltz_boltz2_affinity_predictor_structure_artifacts"
],
"from": "boltz_boltz2_affinity_predictor.structure_artifacts"
},
{
"to": [
"visualisation.boltz_boltz2_affinity_predictor_run_metadata",
"kinase_prediction_interpreter.boltz_boltz2_affinity_predictor_run_metadata"
],
"from": "boltz_boltz2_affinity_predictor.run_metadata"
},
{
"to": [
"visualisation.kinase_prediction_interpreter_prediction_evidence"
],
"from": "kinase_prediction_interpreter.prediction_evidence"
}
],
"package": "boltz-cancer-kinase-workflow",
"runtime": {
"duration": 0.01,
"settle_steps": 1,
"initial_inputs": {},
"python_version": "3.10",
"communication_step": 0.01
},
"version": "1.0.0",
"description": "Guided Boltz-2 workflow for exploring a cancer-relevant ABL1 kinase domain with an imatinib reference ligand example, binder probability, affinity-like value, confidence metrics, and reproducible report context.",
"schema_version": "2.0"
}Runtime
Duration0.01
Comms Step0.01
Settle Steps1
Runs
Total0
Completed0
Failed0
Metadata
Packageboltz-cancer-kinase-workflow
Created2026-05-23
Updated2026-06-13
boltz-workflowboltzprotein-ligandaffinitystructural-biologyguided-workflowgpucancerkinaseabl1contextprovenanceinput-assemblyinterpretationdockingvisualisationother